PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5NG475300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 193aa    MW: 22288.3 Da    PI: 6.5305
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5NG475300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.87e-24958150
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         krien ++rq tf kRr g++KKA ELSvLCd++ ++++fs++gkly y 
  Pavir.5NG475300.2.p  9 KRIENPTQRQSTFYKRRDGLFKKARELSVLCDVDLLLLLFSTSGKLYHYL 58
                         79*********************************************996 PP

2K-box28.18.6e-1172165194
                K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                          y++++++++++   ++ + el+k ++  e +++e+R +  +d e+ ++  L+ Le++Le ++ k+Rs K++ +  +i +l +  +  qee
  Pavir.5NG475300.2.p  72 YEAATHTKVWTDIRQERRAELEKAEQMCELMEKELRFMTVDDGEQYTVPSLELLERNLEAAMHKVRSEKDRKIGGEITYLENIIRGRQEE 161
                          566778889*********************************************************************999887777777 PP

                K-box  91 nkaL 94 
                             L
  Pavir.5NG475300.2.p 162 RYGL 165
                          6655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.6E-32160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.581161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-28291IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-23323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003197.6E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-233859IPR002100Transcription factor, MADS-box
PfamPF014865.8E-1284168IPR002487Transcription factor, K-box
PROSITE profilePS512979.58985176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MGRGRSEIKR IENPTQRQST FYKRRDGLFK KARELSVLCD VDLLLLLFST SGKLYHYLSP  60
TVPSVKDLVE RYEAATHTKV WTDIRQERRA ELEKAEQMCE LMEKELRFMT VDDGEQYTVP  120
SLELLERNLE AAMHKVRSEK DRKIGGEITY LENIIRGRQE ERYGLCDKAL NHDEEAGSTS  180
LSNGLELKLG FN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.203290.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9750460.0EU975046.1 Zea mays clone 465896 MADS-box transcription factor 32 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969809.11e-121PREDICTED: MADS-box transcription factor 32 isoform X1
SwissprotQ8S1511e-115MAD32_ORYSJ; MADS-box transcription factor 32
TrEMBLK3XM651e-121K3XM65_SETIT; Uncharacterized protein
STRINGSi002988m1e-120(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.21e-22MIKC_MADS family protein